PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000176224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 320aa    MW: 35405.3 Da    PI: 9.5052
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000176224genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY33.67.7e-11192213122
                    ---SS-EEEEEEE--TT-SS-E CS
           WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                    ldDgy+WrKYGqK+vk++++pr
  MDP0000176224 192 LDDGYKWRKYGQKVVKNTQHPR 213
                    59*******************9 PP

2WRKY55.79.5e-182612992159
                    -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     rsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  MDP0000176224 261 DRSYYRCTMDNCRVKKRVERLAEDPRMVITTYEGRHVHS 299
                    59************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.8E-31177212IPR003657WRKY domain
SuperFamilySSF1182902.62E-9185214IPR003657WRKY domain
PROSITE profilePS5081120.771187301IPR003657WRKY domain
SMARTSM007747.3E-32192300IPR003657WRKY domain
PfamPF031063.8E-7193214IPR003657WRKY domain
PfamPF031065.0E-12261298IPR003657WRKY domain
SuperFamilySSF1182901.18E-13261300IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-31262299IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MASRTSXAAI LNHHHHQQPL GLFENQEGEG CNTQTDFFPF PQNLTFSSLP LVGHQSLKGG  60
LSTASIASDD APSTTTLSET LVPRPSLTPP LRHKQDHNIT TSSEFGGGGG GGGGGPHGHL  120
LSLQRSTANL WAWGDVSDEY CLSSKRSSGG DDSHHPYLGG LSAMKMKKMK AIRRKVREPR  180
FCFKTLSDVD VLDDGYKWRK YGQKVVKNTQ HPRLLQARLG AGDLMATRVI AHCSPHAGGK  240
RNIESTSSIS SQGSKRYYSG DRSYYRCTMD NCRVKKRVER LAEDPRMVIT TYEGRHVHSP  300
SHDLDDQDSR SPSHLNNFFW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.302490.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392017.10.0PREDICTED: probable WRKY transcription factor 13
TrEMBLD9ZJG01e-161D9ZJG0_MALDO; WRKY domain class transcription factor
STRINGVIT_07s0031g01840.t011e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.17e-48WRKY DNA-binding protein 13